PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_443F1993A.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 342aa    MW: 37021.6 Da    PI: 8.744
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_443F1993A.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.72.9e-31177233158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  Traes_5DS_443F1993A.2 177 DAPIYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 233
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.8E-35175236IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01176236IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-28179233IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-23179201IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860181201IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-23210233IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMSFKNHHEG FAGQQLLAAA AAAASQASGG APLPWWVGSQ LLYGEPMGHG KAPPAVPMSM  60
SPPEDACRDG QFQVVPRAQA LLDAVPLPQP PMGERGIPEA LKFSMAHGKG GNSSEHSAPI  120
TLQSPFTEYN DHFELGLGQS VISSNYYSDQ QYGLLSSYGM RSASSGRMLI PLNMPADAPI  180
YVNAKQYEGI LRRRRARAKA EKENRLVKAR KPYLHESRHL HAMRRARGSG GRFLNTKKET  240
NGKDTGVGSK AMVGNPLMRS AASLSSEIQH SEQGNPSSVS SLSGSEVTSL YDHEDVDHYH  300
NFEHLRTHFF TPLPSIMDGE HGAGNPFKWA AASDGCCNLL KA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-17177241266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787580.0KM078758.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-D6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757443.11e-157PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-157PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_003577268.11e-157PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLW5G2580.0W5G258_WHEAT; Uncharacterized protein
STRINGMLOC_76757.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.11e-28nuclear factor Y, subunit A2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]